IL-7 (Interleukin-7), Mouse
Interleukin 7 (IL-7) is a protein that in humans is encoded by the IL7 gene. IL-7 stimulates the differentiation of multipotent (pluripotent) hematopoietic stem cells into lymphoid progenitor cells. It is important for proliferation during certain stages of B-cell maturation, T and NK cell survival, development and homeostasis.
Sequence:
MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNC
TSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI with polyhistidine tag at the C-terminus
UnitProt ID:
P10168
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 106 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNC
TSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI with polyhistidine tag at the C-terminus
UnitProt ID:
P10168
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 106 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
